PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E01685.1.p
Common NameMIMGU_mgv1a025838mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 190aa    MW: 20891.6 Da    PI: 5.2451
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E01685.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB114.17.5e-36186893
             NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
                      +P +n++rim+ v+P + ki++dake +q cvsefi f+tsea+++c+r+ rkt++++d+l a+++lGf dy+epl v+l+k+r  
  Migut.E01685.1.p  1 MPTTNITRIMRCVVPDHVKIADDAKEAIQVCVSEFINFITSEANNRCHRDYRKTVTPEDVLAAITSLGFGDYIEPLIVFLNKHRAQ 86
                      799********************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-37196IPR009072Histone-fold
SuperFamilySSF471133.73E-311100IPR009072Histone-fold
PfamPF008081.8E-20164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.5E-122846No hitNo description
PRINTSPR006156.5E-124765No hitNo description
PRINTSPR006156.5E-126684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MPTTNITRIM RCVVPDHVKI ADDAKEAIQV CVSEFINFIT SEANNRCHRD YRKTVTPEDV  60
LAAITSLGFG DYIEPLIVFL NKHRAQQDLE RGSMNQLGQF VRRDDDNGGF VHQQQPQGAH  120
MVRSPPAPAP LAAPTMGYYV PLPPPVVGMV EDGEELGGST RVINAFMSCN YGRGEGSSDG  180
PEFDPFHKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-29184891Transcription factor HapC (Eurofung)
4g92_B3e-29184891Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012852535.11e-141PREDICTED: nuclear transcription factor Y subunit beta-like
TrEMBLA0A022Q9Z41e-141A0A022Q9Z4_ERYGU; Uncharacterized protein (Fragment)
STRINGGSMUA_Achr3P04310_0012e-34(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.25e-35nuclear factor Y, subunit B6